About   Help   FAQ
Antibody
Detail
Antibody
Name: Anti-Notch1 intracellular domain antibody (ab83232)
Host: rabbit
Type: Polyclonal
Class: IgG
Note: This antibody was obtained from Abcam (ab83232), immunogen affinity purified.
MGI Accession ID: MGI:5700335
Antigen
Name: Notch1 intracellular domain
Species: human
Region covered: synthetic peptide corresponding to a region within c-terminal amino acids 2506-2555 (EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK)
Gene Notch1  notch 1
Expression Gene Expression Data (1 results)
Reference J:187652 Guo M, et al., Front Biosci (Elite Ed). 2012 Jun 1;4:2631-44
Contributing Projects:
Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB)), Gene Ontology (GO)
Citing These Resources
Funding Information
Warranty Disclaimer, Privacy Notice, Licensing, & Copyright
Send questions and comments to User Support. 		last database update
06/12/2024
MGI 6.13 		The Jackson Laboratory